Sequence objects
Biological sequences are arguably the central object in Bioinformatics,
and in this chapter we’ll introduce the Biopython mechanism for dealing
with sequences, the Seq
object.
Chapter Sequence annotation objects will introduce the
related SeqRecord
object, which combines the sequence information
with any annotation, used again in
Chapter Sequence Input/Output for Sequence Input/Output.
Sequences are essentially strings of letters like AGTACACTGGT
, which
seems very natural since this is the most common way that sequences are
seen in biological file formats.
The most important difference between Seq
objects and standard
Python strings is they have different methods. Although the Seq
object supports many of the same methods as a plain string, its
translate()
method differs by doing biological translation, and
there are also additional biologically relevant methods like
reverse_complement()
.
Sequences act like strings
In most ways, we can deal with Seq objects as if they were normal Python strings, for example getting the length, or iterating over the elements:
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCG")
>>> for index, letter in enumerate(my_seq):
... print("%i %s" % (index, letter))
...
0 G
1 A
2 T
3 C
4 G
>>> print(len(my_seq))
5
You can access elements of the sequence in the same way as for strings (but remember, Python counts from zero!):
>>> print(my_seq[0]) # first letter
G
>>> print(my_seq[2]) # third letter
T
>>> print(my_seq[-1]) # last letter
G
The Seq
object has a .count()
method, just like a string. Note
that this means that like a Python string, this gives a
non-overlapping count:
>>> from Bio.Seq import Seq
>>> "AAAA".count("AA")
2
>>> Seq("AAAA").count("AA")
2
For some biological uses, you may actually want an overlapping count
(i.e.
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> len(my_seq)
32
>>> my_seq.count("G")
9
>>> 100 * (my_seq.count("G") + my_seq.count("C")) / len(my_seq)
46.875
While you could use the above snippet of code to calculate a GC%, note
that the Bio.SeqUtils
module has several GC functions already built.
For example:
>>> from Bio.Seq import Seq
>>> from Bio.SeqUtils import gc_fraction
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> gc_fraction(my_seq)
0.46875
Note that using the Bio.SeqUtils.gc_fraction()
function should
automatically cope with mixed case sequences and the ambiguous
nucleotide S which means G or C.
Also note that just like a normal Python string, the Seq
object is
in some ways “read-only”. If you need to edit your sequence, for example
simulating a point mutation, look at the
Section MutableSeq objects below which talks about the
MutableSeq
object.
Slicing a sequence
A more complicated example, let’s get a slice of the sequence:
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> my_seq[4:12]
Seq('GATGGGCC')
Note that ‘Seq‘ objects follow the usual indexing conventions for Python strings, with the first element of the sequence numbered 0. When you do a slice the first item is included (i.e. 4 in this case) and the last is excluded (12 in this case).
Also like a Python string, you can do slices with a start, stop and stride (the step size, which defaults to one). For example, we can get the first, second and third codon positions of this DNA sequence:
>>> my_seq[0::3]
Seq('GCTGTAGTAAG')
>>> my_seq[1::3]
Seq('AGGCATGCATC')
>>> my_seq[2::3]
Seq('TAGCTAAGAC')
Another stride trick you might have seen with a Python string is the use
of a -1 stride to reverse the string. You can do this with a Seq
object too:
>>> my_seq[::-1]
Seq('CGCTAAAAGCTAGGATATATCCGGGTAGCTAG')
Turning Seq objects into strings
If you really do just need a plain string, for example to write to a file, or insert into a database, then this is very easy to get:
>>> str(my_seq)
'GATCGATGGGCCTATATAGGATCGAAAATCGC'
Since calling str()
on a Seq
object returns the full sequence as
a string, you often don’t actually have to do this conversion
explicitly. Python does this automatically in the print function:
>>> print(my_seq)
GATCGATGGGCCTATATAGGATCGAAAATCGC
You can also use the Seq
object directly with a %s
placeholder
when using the Python string formatting or interpolation operator
(%
):
>>> fasta_format_string = ">Name\n%s\n" % my_seq
>>> print(fasta_format_string)
>Name
GATCGATGGGCCTATATAGGATCGAAAATCGC
This line of code constructs a simple FASTA format record (without
worrying about line wrapping).
Section The format method describes a
neat way to get a FASTA formatted string from a SeqRecord
object,
while the more general topic of reading and writing FASTA format
sequence files is covered in
Chapter Sequence Input/Output.
Concatenating or adding sequences
Two Seq
objects can be concatenated by adding them:
>>> from Bio.Seq import Seq
>>> seq1 = Seq("ACGT")
>>> seq2 = Seq("AACCGG")
>>> seq1 + seq2
Seq('ACGTAACCGG')
Biopython does not check the sequence contents and will not raise an exception if for example you concatenate a protein sequence and a DNA sequence (which is likely a mistake):
>>> from Bio.Seq import Seq
>>> protein_seq = Seq("EVRNAK")
>>> dna_seq = Seq("ACGT")
>>> protein_seq + dna_seq
Seq('EVRNAKACGT')
You may often have many sequences to add together, which can be done with a for loop like this:
>>> from Bio.Seq import Seq
>>> list_of_seqs = [Seq("ACGT"), Seq("AACC"), Seq("GGTT")]
>>> concatenated = Seq("")
>>> for s in list_of_seqs:
... concatenated += s
...
>>> concatenated
Seq('ACGTAACCGGTT')
Like Python strings, Biopython Seq
also has a .join
method:
>>> from Bio.Seq import Seq
>>> contigs = [Seq("ATG"), Seq("ATCCCG"), Seq("TTGCA")]
>>> spacer = Seq("N" * 10)
>>> spacer.join(contigs)
Seq('ATGNNNNNNNNNNATCCCGNNNNNNNNNNTTGCA')
Changing case
Python strings have very useful upper
and lower
methods for
changing the case. For example,
>>> from Bio.Seq import Seq
>>> dna_seq = Seq("acgtACGT")
>>> dna_seq
Seq('acgtACGT')
>>> dna_seq.upper()
Seq('ACGTACGT')
>>> dna_seq.lower()
Seq('acgtacgt')
These are useful for doing case insensitive matching:
>>> "GTAC" in dna_seq
False
>>> "GTAC" in dna_seq.upper()
True
Nucleotide sequences and (reverse) complements
For nucleotide sequences, you can easily obtain the complement or
reverse complement of a Seq
object using its built-in methods:
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> my_seq
Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC')
>>> my_seq.complement()
Seq('CTAGCTACCCGGATATATCCTAGCTTTTAGCG')
>>> my_seq.reverse_complement()
Seq('GCGATTTTCGATCCTATATAGGCCCATCGATC')
As mentioned earlier, an easy way to just reverse a Seq
object (or a
Python string) is slice it with -1 step:
>>> my_seq[::-1]
Seq('CGCTAAAAGCTAGGATATATCCGGGTAGCTAG')
If you do accidentally end up trying to do something weird like taking the (reverse) complement of a protein sequence, the results are biologically meaningless:
>>> from Bio.Seq import Seq
>>> protein_seq = Seq("EVRNAK")
>>> protein_seq.complement()
Seq('EBYNTM')
Here the letter “E” is not a valid IUPAC ambiguity code for nucleotides, so was not complemented. However, “V” means “A”, “C” or “G” and has complement “B“, and so on.
The example in
Section Converting a file of sequences to their reverse complements
combines the Seq
object’s reverse complement method with
Bio.SeqIO
for sequence input/output.
Transcription
Before talking about transcription, I want to try to clarify the strand issue. Consider the following (made up) stretch of double stranded DNA which encodes a short peptide:
Transcription of this DNA sequence produces the following RNA sequence:
The actual biological transcription process works from the template
strand, doing a reverse complement (TCAG
Now let’s actually get down to doing a transcription in Biopython.
First, let’s create Seq
objects for the coding and template DNA
strands:
>>> from Bio.Seq import Seq
>>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG")
>>> coding_dna
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
>>> template_dna = coding_dna.reverse_complement()
>>> template_dna
Seq('CTATCGGGCACCCTTTCAGCGGCCCATTACAATGGCCAT')
These should match the figure above - remember by convention nucleotide sequences are normally read from the 5’ to 3’ direction, while in the figure the template strand is shown reversed.
Now let’s transcribe the coding strand into the corresponding mRNA,
using the Seq
object’s built-in transcribe
method:
>>> coding_dna
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
>>> messenger_rna = coding_dna.transcribe()
>>> messenger_rna
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
As you can see, all this does is to replace T by U.
If you do want to do a true biological transcription starting with the template strand, then this becomes a two-step process:
>>> template_dna.reverse_complement().transcribe()
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
The Seq
object also includes a back-transcription method for going
from the mRNA to the coding strand of the DNA. Again, this is a simple U
>>> from Bio.Seq import Seq
>>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG")
>>> messenger_rna
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
>>> messenger_rna.back_transcribe()
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
Note: The Seq
object’s transcribe
and back_transcribe
methods were added in Biopython 1.49. For older releases you would have
to use the Bio.Seq
module’s functions instead, see
Section Working with strings directly.
Translation
Sticking with the same example discussed in the transcription section
above, now let’s translate this mRNA into the corresponding protein
sequence - again taking advantage of one of the Seq
object’s
biological methods:
>>> from Bio.Seq import Seq
>>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG")
>>> messenger_rna
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
>>> messenger_rna.translate()
Seq('MAIVMGR*KGAR*')
You can also translate directly from the coding strand DNA sequence:
>>> from Bio.Seq import Seq
>>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG")
>>> coding_dna
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
>>> coding_dna.translate()
Seq('MAIVMGR*KGAR*')
You should notice in the above protein sequences that in addition to the end stop character, there is an internal stop as well. This was a deliberate choice of example, as it gives an excuse to talk about some optional arguments, including different translation tables (Genetic Codes).
The translation tables available in Biopython are based on those from the NCBI (see the next section of this tutorial). By default, translation will use the standard genetic code (NCBI table id 1). Suppose we are dealing with a mitochondrial sequence. We need to tell the translation function to use the relevant genetic code instead:
>>> coding_dna.translate(table="Vertebrate Mitochondrial")
Seq('MAIVMGRWKGAR*')
You can also specify the table using the NCBI table number which is shorter, and often included in the feature annotation of GenBank files:
>>> coding_dna.translate(table=2)
Seq('MAIVMGRWKGAR*')
Now, you may want to translate the nucleotides up to the first in frame stop codon, and then stop (as happens in nature):
>>> coding_dna.translate()
Seq('MAIVMGR*KGAR*')
>>> coding_dna.translate(to_stop=True)
Seq('MAIVMGR')
>>> coding_dna.translate(table=2)
Seq('MAIVMGRWKGAR*')
>>> coding_dna.translate(table=2, to_stop=True)
Seq('MAIVMGRWKGAR')
Notice that when you use the to_stop
argument, the stop codon itself
is not translated - and the stop symbol is not included at the end of
your protein sequence.
You can even specify the stop symbol if you don’t like the default asterisk:
>>> coding_dna.translate(table=2, stop_symbol="@")
Seq('MAIVMGRWKGAR@')
Now, suppose you have a complete coding sequence CDS, which is to say a
nucleotide sequence (e.g. mRNA – after any splicing) which is a whole
number of codons (i.e. the length is a multiple of three), commences
with a start codon, ends with a stop codon, and has no internal in-frame
stop codons. In general, given a complete CDS, the default translate
method will do what you want (perhaps with the to_stop
option).
However, what if your sequence uses a non-standard start codon? This
happens a lot in bacteria – for example the gene yaaX in E. coli
K12:
>>> from Bio.Seq import Seq
>>> gene = Seq(
... "GTGAAAAAGATGCAATCTATCGTACTCGCACTTTCCCTGGTTCTGGTCGCTCCCATGGCA"
... "GCACAGGCTGCGGAAATTACGTTAGTCCCGTCAGTAAAATTACAGATAGGCGATCGTGAT"
... "AATCGTGGCTATTACTGGGATGGAGGTCACTGGCGCGACCACGGCTGGTGGAAACAACAT"
... "TATGAATGGCGAGGCAATCGCTGGCACCTACACGGACCGCCGCCACCGCCGCGCCACCAT"
... "AAGAAAGCTCCTCATGATCATCACGGCGGTCATGGTCCAGGCAAACATCACCGCTAA"
... )
>>> gene.translate(table="Bacterial")
Seq('VKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDH...HR*',
ProteinAlpabet())
>>> gene.translate(table="Bacterial", to_stop=True)
Seq('VKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDH...HHR')
In the bacterial genetic code GTG
is a valid start codon, and while
it does normally encode Valine, if used as a start codon it should be
translated as methionine. This happens if you tell Biopython your
sequence is a complete CDS:
>>> gene.translate(table="Bacterial", cds=True)
Seq('MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDH...HHR')
In addition to telling Biopython to translate an alternative start codon as methionine, using this option also makes sure your sequence really is a valid CDS (you’ll get an exception if not).
The example in Section Translating a FASTA file of CDS entries
combines the Seq
object’s translate method with Bio.SeqIO
for
sequence input/output.
Translation Tables
In the previous sections we talked about the Seq
object translation
method (and mentioned the equivalent function in the Bio.Seq
module
– see Section Working with strings directly). Internally these
use codon table objects derived from the NCBI information at
ftp://ftp.ncbi.nlm.nih.gov/entrez/misc/data/gc.prt, also shown on
https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi in a much more
readable layout.
As before, let’s just focus on two choices: the Standard translation table, and the translation table for Vertebrate Mitochondrial DNA.
>>> from Bio.Data import CodonTable
>>> standard_table = CodonTable.unambiguous_dna_by_name["Standard"]
>>> mito_table = CodonTable.unambiguous_dna_by_name["Vertebrate Mitochondrial"]
Alternatively, these tables are labeled with ID numbers 1 and 2, respectively:
>>> from Bio.Data import CodonTable
>>> standard_table = CodonTable.unambiguous_dna_by_id[1]
>>> mito_table = CodonTable.unambiguous_dna_by_id[2]
You can compare the actual tables visually by printing them:
>>> print(standard_table)
Table 1 Standard, SGC0
| T | C | A | G |
--+---------+---------+---------+---------+--
T | TTT F | TCT S | TAT Y | TGT C | T
T | TTC F | TCC S | TAC Y | TGC C | C
T | TTA L | TCA S | TAA Stop| TGA Stop| A
T | TTG L(s)| TCG S | TAG Stop| TGG W | G
--+---------+---------+---------+---------+--
C | CTT L | CCT P | CAT H | CGT R | T
C | CTC L | CCC P | CAC H | CGC R | C
C | CTA L | CCA P | CAA Q | CGA R | A
C | CTG L(s)| CCG P | CAG Q | CGG R | G
--+---------+---------+---------+---------+--
A | ATT I | ACT T | AAT N | AGT S | T
A | ATC I | ACC T | AAC N | AGC S | C
A | ATA I | ACA T | AAA K | AGA R | A
A | ATG M(s)| ACG T | AAG K | AGG R | G
--+---------+---------+---------+---------+--
G | GTT V | GCT A | GAT D | GGT G | T
G | GTC V | GCC A | GAC D | GGC G | C
G | GTA V | GCA A | GAA E | GGA G | A
G | GTG V | GCG A | GAG E | GGG G | G
--+---------+---------+---------+---------+--
and:
>>> print(mito_table)
Table 2 Vertebrate Mitochondrial, SGC1
| T | C | A | G |
--+---------+---------+---------+---------+--
T | TTT F | TCT S | TAT Y | TGT C | T
T | TTC F | TCC S | TAC Y | TGC C | C
T | TTA L | TCA S | TAA Stop| TGA W | A
T | TTG L | TCG S | TAG Stop| TGG W | G
--+---------+---------+---------+---------+--
C | CTT L | CCT P | CAT H | CGT R | T
C | CTC L | CCC P | CAC H | CGC R | C
C | CTA L | CCA P | CAA Q | CGA R | A
C | CTG L | CCG P | CAG Q | CGG R | G
--+---------+---------+---------+---------+--
A | ATT I(s)| ACT T | AAT N | AGT S | T
A | ATC I(s)| ACC T | AAC N | AGC S | C
A | ATA M(s)| ACA T | AAA K | AGA Stop| A
A | ATG M(s)| ACG T | AAG K | AGG Stop| G
--+---------+---------+---------+---------+--
G | GTT V | GCT A | GAT D | GGT G | T
G | GTC V | GCC A | GAC D | GGC G | C
G | GTA V | GCA A | GAA E | GGA G | A
G | GTG V(s)| GCG A | GAG E | GGG G | G
--+---------+---------+---------+---------+--
You may find these following properties useful – for example if you are trying to do your own gene finding:
>>> mito_table.stop_codons
['TAA', 'TAG', 'AGA', 'AGG']
>>> mito_table.start_codons
['ATT', 'ATC', 'ATA', 'ATG', 'GTG']
>>> mito_table.forward_table["ACG"]
'T'
Comparing Seq objects
Sequence comparison is actually a very complicated topic, and there is
no easy way to decide if two sequences are equal. The basic problem is
the meaning of the letters in a sequence are context dependent - the
letter “A” could be part of a DNA, RNA or protein sequence. Biopython
can track the molecule type, so comparing two Seq
objects could mean
considering this too.
Should a DNA fragment “ACG” and an RNA fragment “ACG” be equal? What about the peptide “ACG”? Or the Python string “ACG”? In everyday use, your sequences will generally all be the same type of (all DNA, all RNA, or all protein). Well, as of Biopython 1.65, sequence comparison only looks at the sequence and compares like the Python string.
>>> from Bio.Seq import Seq
>>> seq1 = Seq("ACGT")
>>> "ACGT" == seq1
True
>>> seq1 == "ACGT"
True
As an extension to this, using sequence objects as keys in a Python dictionary is equivalent to using the sequence as a plain string for the key. See also Section Turning Seq objects into strings.
Sequences with unknown sequence contents
In some cases, the length of a sequence may be known but not the actual
letters constituting it. For example, GenBank and EMBL files may
represent a genomic DNA sequence only by its config information, without
specifying the sequence contents explicitly. Such sequences can be
represented by creating a Seq
object with the argument None
,
followed by the sequence length:
>>> from Bio.Seq import Seq
>>> unknown_seq = Seq(None, 10)
The Seq
object thus created has a well-defined length. Any attempt
to access the sequence contents, however, will raise an
UndefinedSequenceError
:
>>> unknown_seq
Seq(None, length=10)
>>> len(unknown_seq)
10
>>> print(unknown_seq)
Traceback (most recent call last):
...
Bio.Seq.UndefinedSequenceError: Sequence content is undefined
>>>
Sequences with partially defined sequence contents
Sometimes the sequence contents is defined for parts of the sequence only, and undefined elsewhere. For example, the following excerpt of a MAF (Multiple Alignment Format) file shows an alignment of human, chimp, macaque, mouse, rat, dog, and opossum genome sequences:
s hg38.chr7 117512683 36 + 159345973 TTGAAAACCTGAATGTGAGAGTCAGTCAAGGATAGT
s panTro4.chr7 119000876 36 + 161824586 TTGAAAACCTGAATGTGAGAGTCACTCAAGGATAGT
s rheMac3.chr3 156330991 36 + 198365852 CTGAAATCCTGAATGTGAGAGTCAATCAAGGATGGT
s mm10.chr6 18207101 36 + 149736546 CTGAAAACCTAAGTAGGAGAATCAACTAAGGATAAT
s rn5.chr4 42326848 36 + 248343840 CTGAAAACCTAAGTAGGAGAGACAGTTAAAGATAAT
s canFam3.chr14 56325207 36 + 60966679 TTGAAAAACTGATTATTAGAGTCAATTAAGGATAGT
s monDom5.chr8 173163865 36 + 312544902 TTAAGAAACTGGAAATGAGGGTTGAATGACAAACTT
In each row, the first number indicates the starting position (in zero-based coordinates) of the aligned sequence on the chromosome, followed by the size of the aligned sequence, the strand, the size of the full chromosome, and the aligned sequence.
A Seq
object representing such a partially defined sequence can be
created using a dictionary for the data
argument, where the keys are
the starting coordinates of the known sequence segments, and the values
are the corresponding sequence contents. For example, for the first
sequence we would use
>>> from Bio.Seq import Seq
>>> seq = Seq({117512683: "TTGAAAACCTGAATGTGAGAGTCAGTCAAGGATAGT"}, length=159345973)
Extracting a subsequence from a partially define sequence may return a fully defined sequence, an undefined sequence, or a partially defined sequence, depending on the coordinates:
>>> seq[1000:1020]
Seq(None, length=20)
>>> seq[117512690:117512700]
Seq('CCTGAATGTG')
>>> seq[117512670:117512690]
Seq({13: 'TTGAAAA'}, length=20)
>>> seq[117512700:]
Seq({0: 'AGAGTCAGTCAAGGATAGT'}, length=41833273)
Partially defined sequences can also be created by appending sequences, if at least one of the sequences is partially or fully undefined:
>>> seq = Seq("ACGT")
>>> undefined_seq = Seq(None, length=10)
>>> seq + undefined_seq + seq
Seq({0: 'ACGT', 14: 'ACGT'}, length=18)
MutableSeq objects
Just like the normal Python string, the Seq
object is “read only”,
or in Python terminology, immutable. Apart from wanting the Seq
object to act like a string, this is also a useful default since in many
biological applications you want to ensure you are not changing your
sequence data:
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA")
Observe what happens if you try to edit the sequence:
>>> my_seq[5] = "G"
Traceback (most recent call last):
...
TypeError: 'Seq' object does not support item assignment
However, you can convert it into a mutable sequence (a MutableSeq
object) and do pretty much anything you want with it:
>>> from Bio.Seq import MutableSeq
>>> mutable_seq = MutableSeq(my_seq)
>>> mutable_seq
MutableSeq('GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA')
Alternatively, you can create a MutableSeq
object directly from a
string:
>>> from Bio.Seq import MutableSeq
>>> mutable_seq = MutableSeq("GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA")
Either way will give you a sequence object which can be changed:
>>> mutable_seq
MutableSeq('GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA')
>>> mutable_seq[5] = "C"
>>> mutable_seq
MutableSeq('GCCATCGTAATGGGCCGCTGAAAGGGTGCCCGA')
>>> mutable_seq.remove("T")
>>> mutable_seq
MutableSeq('GCCACGTAATGGGCCGCTGAAAGGGTGCCCGA')
>>> mutable_seq.reverse()
>>> mutable_seq
MutableSeq('AGCCCGTGGGAAAGTCGCCGGGTAATGCACCG')
Note that the MutableSeq
object’s reverse()
method, like the
reverse()
method of a Python list, reverses the sequence in place.
An important technical difference between mutable and immutable objects
in Python means that you can’t use a MutableSeq
object as a
dictionary key, but you can use a Python string or a Seq
object in
this way.
Once you have finished editing your a MutableSeq
object, it’s easy
to get back to a read-only Seq
object should you need to:
>>> from Bio.Seq import Seq
>>> new_seq = Seq(mutable_seq)
>>> new_seq
Seq('AGCCCGTGGGAAAGTCGCCGGGTAATGCACCG')
You can also get a string from a MutableSeq
object just like from a
Seq
object (Section Turning Seq objects into strings).
Finding subsequences
Sequence objects have find
, rfind
, index
, and rindex
methods that perform the same function as the corresponding methods
on plain string objects. The only difference is that the subsequence
can be a string (str
), bytes
, bytearray
, Seq
, or
MutableSeq
object:
>>> from Bio.Seq import Seq, MutableSeq
>>> seq = Seq("GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA")
>>> seq.index("ATGGGCCGC")
9
>>> seq.index(b"ATGGGCCGC")
9
>>> seq.index(bytearray(b"ATGGGCCGC"))
9
>>> seq.index(Seq("ATGGGCCGC"))
9
>>> seq.index(MutableSeq("ATGGGCCGC"))
9
A ValueError
is raised if the subsequence is not found:
>>> seq.index("ACTG")
Traceback (most recent call last):
...
ValueError: ...
while the find
method returns -1 if the subsequence is not found:
>>> seq.find("ACTG")
-1
The methods rfind
and rindex
search for the subsequence starting
from the right hand side of the sequence:
>>> seq.find("CC")
1
>>> seq.rfind("CC")
29
Use the search
method to search for multiple subsequences at the same
time. This method returns an iterator:
>>> for index, sub in seq.search(["CC", "GGG", "CC"]):
... print(index, sub)
...
1 CC
11 GGG
14 CC
23 GGG
28 CC
29 CC
The search
method also takes plain strings, bytes
, bytearray
,
Seq
, and MutableSeq
objects as subsequences; identical subsequences
are reported only once, as in the example above.
Working with strings directly
To close this chapter, for those you who really don’t want to use the
sequence objects (or who prefer a functional programming style to an
object orientated one), there are module level functions in Bio.Seq
will accept plain Python strings, Seq
objects or MutableSeq
objects:
>>> from Bio.Seq import reverse_complement, transcribe, back_transcribe, translate
>>> my_string = "GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGTTAG"
>>> reverse_complement(my_string)
'CTAACCAGCAGCACGACCACCCTTCCAACGACCCATAACAGC'
>>> transcribe(my_string)
'GCUGUUAUGGGUCGUUGGAAGGGUGGUCGUGCUGCUGGUUAG'
>>> back_transcribe(my_string)
'GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGTTAG'
>>> translate(my_string)
'AVMGRWKGGRAAG*'
You are, however, encouraged to work with Seq
objects by default.