Package Bio :: Package SeqUtils :: Module ProtParam
[hide private]
[frames] | no frames]

Module ProtParam

source code

Simple protein analysis.

Example:

>>> from Bio.SeqUtils.ProtParam import ProteinAnalysis
>>> X = ProteinAnalysis("MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGT"
...                     "RDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEEC"
...                     "LFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILF"
...                     "LPLPV")
>>> print(X.count_amino_acids()['A'])
6
>>> print(X.count_amino_acids()['E'])
12
>>> print("%0.2f" % X.get_amino_acids_percent()['A'])
0.04
>>> print("%0.2f" % X.get_amino_acids_percent()['L'])
0.12
>>> print("%0.2f" % X.molecular_weight())
17103.16
>>> print("%0.2f" % X.aromaticity())
0.10
>>> print("%0.2f" % X.instability_index())
41.98
>>> print("%0.2f" % X.isoelectric_point())
7.72
>>> sec_struc = X.secondary_structure_fraction()  # [helix, turn, sheet]
>>> print("%0.2f" % sec_struc[0])  # helix
0.28
>>> epsilon_prot = X.molar_extinction_coefficient()  # [reduced, oxidized]
>>> print(epsilon_prot[0])  # with reduced cysteines
17420
>>> print(epsilon_prot[1])  # with disulfid bridges
17545
Other public methods are:
  • gravy
  • protein_scale
  • flexibility
Classes [hide private]
  ProteinAnalysis
Class containing methods for protein analysis.
Variables [hide private]
  __package__ = 'Bio.SeqUtils'